Recombinant Human/Mouse FGF-8B Protein
Product Sizes
10 ug
£145.00
RP01659-10UG
20 ug
£193.00
RP01659-20UG
50 ug
£288.00
RP01659-50UG
100 ug
£431.00
RP01659-100UG
500 ug
£1240.00
RP01659-500UG
1000 ug
£1954.00
RP01659-1000UG
About this Product
- SKU:
- RP01659
- Additional Names:
- AIGF|FGF-8|FGF8B|HBGF-8|HH6|KAL6
- Extra Details:
- In mammalian embryos, transient Fgf8 expression defines the developing isthmic region, lying between the midbrain and the first rhombomere, but there has been uncertainty about the existence of a distinct isthmic segment in postnatal mammals. Retinoic acid (RA) directly represses Fgf8 through a RARE-mediated mechanism that promotes repressive chromatin, thus providing valuable insight into the mechanism of RA-FGF antagonism during progenitor cell differentiation. Fgf8 encodes a key signaling factor, and its precise regulation is essential for embryo patterning.
- Formulation:
- Recombinant Human/Mouse FGF-8B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Arg215) of human FGF-8B (Accession #NP_006110.1) fused with a
- Immunogen:
- Gln23-Arg215
- Molecular Weight:
- 35-45kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01659
