Recombinant Human CXCL2/MIP-2 Protein
Product Sizes
10 ug
£133.00
RP01656-10UG
20 ug
£181.00
RP01656-20UG
100 ug
£353.00
RP01656-100UG
About this Product
- SKU:
- RP01656
- Additional Names:
- CINC-2a|CXCL2|GRO2|GROb|MGSA-b|MIP-2a|MIP2|MIP2A|SCYB2
- Extra Details:
- Recombinant Human CXCL2/MIP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL2/MIP-2 (Accession #NP_002080.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala35-Asn107
- Molecular Weight:
- 7.89 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01656
