Recombinant Human CCL4/MIP-1B Beta Protein
Product Sizes
10 ug
£127.00
RP01654-10UG
20 ug
£175.00
RP01654-20UG
50 ug
£240.00
RP01654-50UG
100 ug
£336.00
RP01654-100UG
500 ug
£1002.00
RP01654-500UG
1000 ug
£1574.00
RP01654-1000UG
About this Product
- SKU:
- RP01654
- Additional Names:
- ACT2|AT744.1|CCL4|G-26|HC21|LAG-1|LAG1|MIP-1-beta|MIP1B|MIP1B1|SCYA2|SCYA4
- Extra Details:
- Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
- Formulation:
- Recombinant Human CCL4/MIP-1B Beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Asn92) of human CCL4/MIP-1B Beta (Accession #NP_002975.1)
- Immunogen:
- Ala24-Asn92
- Molecular Weight:
- 40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01654
