Recombinant Human CD9 Protein
Product Sizes
10 ug
£163.00
RP01652-10UG
20 ug
£223.00
RP01652-20UG
50 ug
£336.00
RP01652-50UG
100 ug
£508.00
RP01652-100UG
500 ug
£1478.00
RP01652-500UG
1000 ug
£2335.00
RP01652-1000UG
About this Product
- SKU:
- RP01652
- Additional Names:
- BTCC-1|CD9|DRAP-27|MIC3|MRP-1|TSPAN-29|TSPAN29
- Extra Details:
- CD9 is a member of the transmembrane 4 superfamily, which is also known as the tetraspanin family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains that are described as complex with integrins and other transmembrane 4 superfamily members. It is found expressed on the surface of the exosomes. The protein takes part in cellular signal transduction events and thus play a role in the regulation of cell development and activation, growth and motility. Besides, CD9 seems to be a key role in the egg-sperm fusion during the mammalian fertilization processes. CD9 is found on the membrane of the oocytes and also appears to intervene in maintaining the normal shape of oocyte microvilli.
- Formulation:
- Recombinant Human CD9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser112-Ile195) of human CD9 (Accession #NP_001760.1) fused with and a hFc ta
- Immunogen:
- Ser112-Ile195
- Molecular Weight:
- 42-47 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01652
