Recombinant Mouse Oncostatin-M/OSM Protein
Product Sizes
10 ug
£145.00
RP01639-10UG
20 ug
£193.00
RP01639-20UG
50 ug
£288.00
RP01639-50UG
100 ug
£431.00
RP01639-100UG
500 ug
£1240.00
RP01639-500UG
1000 ug
£1954.00
RP01639-1000UG
About this Product
- SKU:
- RP01639
- Additional Names:
- OncoM|OSM
- Extra Details:
- OSM is a pleiotropic cytokine that initiates its biological activities by binding to specific cell surface receptors. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
- Formulation:
- Recombinant Mouse Oncostatin-M/OSM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Arg 206) of mouse Oncostatin-M/OSM (Accession #NP_0010133
- Immunogen:
- Met 1-Arg 206
- Molecular Weight:
- 35-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MQTRLLRTLLSLTLSLLILSMALANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01639
