Recombinant Human CXCL10/IP-10 Protein

Product Sizes

10 ug

£133.00

RP01638-10UG

20 ug

£181.00

RP01638-20UG

50 ug

£240.00

RP01638-50UG

100 ug

£353.00

RP01638-100UG

500 ug

£1002.00

RP01638-500UG

1000 ug

£1574.00

RP01638-1000UG

About this Product

SKU:: RP01638
Additional Names:: CXCL10, INP10, SCYB10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Gamma-IP10, IP-10, Small-inducible cytokine B10, Cleaved into: CXCL10(1-73)
Extra Details:: C-X-C Motif Chemokine Ligand 10 (CXCL10) is a pro-inflammatory chemokine secreted by a wide spectrum of cells. It is involved in multiple mechanisms and reported to have pleiotropic effects, including immune cell migration and attraction to inflammation sites, angiogenesis, and cancer cell growth. CXCL10 is produced by pancreatic islet cells upon inflammatory stress and is specifically recognized by C-X-C Motif Chemokine Receptor 3 (CXCR3) which is expressed by activated T-lymphocytes and other immune cells.
Formulation:: Recombinant Human CXCL10/IP-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Pro98) of Human CXCL10/IP-10 Protein (Accession #NP_001556.2) fuse
Immunogen:: Val22-Pro98
Molecular Weight:: 15 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket