Recombinant Human CXCL10/IP-10 Protein
Product Sizes
10 ug
£133.00
RP01638-10UG
20 ug
£181.00
RP01638-20UG
50 ug
£240.00
RP01638-50UG
100 ug
£353.00
RP01638-100UG
About this Product
- SKU:
- RP01638
- Additional Names:
- CXCL10, INP10, SCYB10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Gamma-IP10, IP-10, Small-inducible cytokine B10, Cleaved into: CXCL10(1-73)
- Extra Details:
- Recombinant Human CXCL10/IP-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Pro98) of Human CXCL10/IP-10 Protein (Accession #NP_001556.2) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val22-Pro98
- Molecular Weight:
- 8.6 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01638
