Recombinant Human CXCL12/SDF-1 Protein
Product Sizes
10 ug
£145.00
RP01637-10UG
20 ug
£193.00
RP01637-20UG
50 ug
£288.00
RP01637-50UG
100 ug
£431.00
RP01637-100UG
500 ug
£1240.00
RP01637-500UG
1000 ug
£1954.00
RP01637-1000UG
About this Product
- SKU:
- RP01637
- Additional Names:
- CXCL12|IRH|PBSF|SCYB12|SDF1|TLSF|TPAR1
- Extra Details:
- Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).
- Formulation:
- Recombinant Human CXCL12/SDF-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys22-Lys89) of human CXCL12/SDF-1 (Accession #NP_954637.1.) fused with n
- Immunogen:
- Lys22-Lys89(M)
- Molecular Weight:
- 12 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01637
