Recombinant Human Collagen I alpha 2/COL1A2 Protein
Product Sizes
10 ug
£133.00
RP01630-10UG
20 ug
£181.00
RP01630-20UG
50 ug
£240.00
RP01630-50UG
100 ug
£353.00
RP01630-100UG
500 ug
£1002.00
RP01630-500UG
1000 ug
£1574.00
RP01630-1000UG
About this Product
- SKU:
- RP01630
- Additional Names:
- COL1A2,OI4
- Extra Details:
- Recombinant Human Collagen I alpha 2/COL1A2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp1120-Lys1366) of human Collagen I alpha 2/COL1A2 (Accession #NP_000080.2) fused with and a hFc tag at the C-terminus.
- Formulation:
- Recombinant Human Collagen I alpha 2/COL1A2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp1120-Lys1366) of human Collagen I alpha 2/COL1A2 (A
- Immunogen:
- Asp1120-Lys1366
- Molecular Weight:
- 60-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01630
