Recombinant Human CCL3/MIP-1 alpha Protein
Product Sizes
10 ug
£133.00
RP01628-10UG
20 ug
£181.00
RP01628-20UG
50 ug
£240.00
RP01628-50UG
100 ug
£353.00
RP01628-100UG
500 ug
£1002.00
RP01628-500UG
1000 ug
£1574.00
RP01628-1000UG
About this Product
- SKU:
- RP01628
- Additional Names:
- CCL3,G0S19-1,LD78ALPHA,MIP-1-alpha,MIP1A,SCYA3
- Extra Details:
- This protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
- Formulation:
- Recombinant Human CCL3/MIP-1 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala23-Ala92) of human CCL3/MIP-1 alpha (Accession #NP_002974.1)
- Immunogen:
- Ala23-Ala92
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01628
