Recombinant Human CCL3/MIP-1 alpha Protein
Product Sizes
10 ug
£133.00
RP01628-10UG
20 ug
£181.00
RP01628-20UG
50 ug
£240.00
RP01628-50UG
100 ug
£353.00
RP01628-100UG
About this Product
- SKU:
- RP01628
- Additional Names:
- CCL3,G0S19-1,LD78ALPHA,MIP-1-alpha,MIP1A,SCYA3
- Extra Details:
- Recombinant Human CCL3/MIP-1 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala23-Ala92) of human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala23-Ala92
- Molecular Weight:
- 8.63 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01628
