Recombinant Mouse CCL2/MCP-1 Protein
Product Sizes
20 ug
£193.00
RP01626-20UG
50 ug
£288.00
RP01626-50UG
100 ug
£431.00
RP01626-100UG
About this Product
- SKU:
- RP01626
- Additional Names:
- C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF,CCL2
- Extra Details:
- Recombinant Mouse CCL2/MCP-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln 24-Asn148) of mouse CCL2/MCP-1 (Accession #NP_035463.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln 24-Asn148
- Molecular Weight:
- 13.85 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01626
