Recombinant Mouse CXCL10/IP-10 Protein
Product Sizes
10 ug
£133.00
RP01625-10UG
20 ug
£181.00
RP01625-20UG
50 ug
£240.00
RP01625-50UG
100 ug
£353.00
RP01625-100UG
About this Product
- SKU:
- RP01625
- Additional Names:
- C7|CRG-2|gIP-10,CXCL10|Ifi10|INP10|IP-10|IP10|mob-1|Scyb10
- Extra Details:
- Recombinant Mouse CXCL10/IP-10 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ile22-Pro98) of mouse CXCL10/IP-10 (Accession #NP_067249.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ile22-Pro98
- Molecular Weight:
- 8.70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01625
