Recombinant Mouse CXCL10/IP-10 Protein
Product Sizes
10 ug
£133.00
RP01625-10UG
20 ug
£181.00
RP01625-20UG
50 ug
£240.00
RP01625-50UG
100 ug
£353.00
RP01625-100UG
500 ug
£1002.00
RP01625-500UG
1000 ug
£1574.00
RP01625-1000UG
About this Product
- SKU:
- RP01625
- Additional Names:
- C7|CRG-2|gIP-10,CXCL10|Ifi10|INP10|IP-10|IP10|mob-1|Scyb10
- Extra Details:
- C-X-C motif ligand 10 (CXCL10), or interferon-inducible protein-10, is a small chemokine belonging to the CXC chemokine family. Its members are responsible for leukocyte trafficking and act on tissue cells, like endothelial and vascular smooth muscle cells. CXCL10 is secreted by leukocytes and tissue cells and functions as a chemoattractant, mainly for lymphocytes.
- Formulation:
- Recombinant Mouse CXCL10/IP-10 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ile22-Pro98) of mouse CXCL10/IP-10 (Accession #NP_067249.1) fused with no
- Immunogen:
- Ile22-Pro98
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01625
