Recombinant Human CXCL1/GRO-alpha Protein
Product Sizes
10 ug
£127.00
RP01623-10UG
20 ug
£157.00
RP01623-20UG
50 ug
£223.00
RP01623-50UG
100 ug
£336.00
RP01623-100UG
500 ug
£907.00
RP01623-500UG
1000 ug
£1478.00
RP01623-1000UG
About this Product
- SKU:
- RP01623
- Additional Names:
- CXCL1,FSP,GRO1,GROa,MGSA,MGSA-a,NAP-3,SCYB1,GRO alpha
- Extra Details:
- This antimicrobial protein belongs a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
- Formulation:
- Recombinant Human CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL1/GRO-alpha (Accession #NP_001502.1)
- Immunogen:
- Ala35-Asn107
- Molecular Weight:
- 40-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01623
