Recombinant Human CXCL1/GRO-alpha Protein

Product Sizes

10 ug

£127.00

RP01623-10UG

20 ug

£157.00

RP01623-20UG

50 ug

£223.00

RP01623-50UG

100 ug

£336.00

RP01623-100UG

500 ug

£907.00

RP01623-500UG

1000 ug

£1478.00

RP01623-1000UG

About this Product

SKU:: RP01623
Additional Names:: CXCL1,FSP,GRO1,GROa,MGSA,MGSA-a,NAP-3,SCYB1,GRO alpha
Extra Details:: This antimicrobial protein belongs a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
Formulation:: Recombinant Human CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL1/GRO-alpha (Accession #NP_001502.1)
Immunogen:: Ala35-Asn107
Molecular Weight:: 40-45 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket