Recombinant Mouse BTLA/CD272 Protein
Product Sizes
10 ug
£145.00
RP01620-10UG
20 ug
£193.00
RP01620-20UG
50 ug
£288.00
RP01620-50UG
100 ug
£431.00
RP01620-100UG
About this Product
- SKU:
- RP01620
- Additional Names:
- BTLA|BTLA1|CD272|FLJ16065|MGC129743,BTLA
- Extra Details:
- Recombinant Mouse BTLA/CD272 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu30-Pro176) of mouse BTLA (Accession #NP_001032808.2) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu30-Pro176
- Molecular Weight:
- 42.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01620
