Recombinant Mouse BTLA/CD272 Protein
Product Sizes
10 ug
£145.00
RP01620-10UG
20 ug
£193.00
RP01620-20UG
50 ug
£288.00
RP01620-50UG
100 ug
£431.00
RP01620-100UG
500 ug
£1240.00
RP01620-500UG
1000 ug
£1954.00
RP01620-1000UG
About this Product
- SKU:
- RP01620
- Additional Names:
- BTLA|BTLA1|CD272|FLJ16065|MGC129743,BTLA
- Extra Details:
- B- and T-lymphocyte attenuator (BTLA; CD272) is a 35 kDa type I transmembrane glycoprotein in the CD28 family of T cell costimulatory molecules. BTLA is a inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. BTLA may interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14.
- Formulation:
- Recombinant Mouse BTLA/CD272 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu30-Pro176) of mouse BTLA (Accession #NP_001032808.2) fused with a
- Immunogen:
- Glu30-Pro176
- Molecular Weight:
- 60-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01620
