Recombinant Human IL-22 Protein
Product Sizes
10 ug
£145.00
RP01616-10UG
20 ug
£193.00
RP01616-20UG
50 ug
£288.00
RP01616-50UG
100 ug
£431.00
RP01616-100UG
500 ug
£1240.00
RP01616-500UG
1000 ug
£1954.00
RP01616-1000UG
About this Product
- SKU:
- RP01616
- Additional Names:
- Cytokine Zcyto18|IL-22|IL-D110|IL-TIF|Interleukin-22|TIFa|TIFIL-23|ZCYTO18,IL22
- Extra Details:
- The cytokine interleukin-22 (IL-22) is a critical regulator of epithelial homeostasis. It has been implicated in multiple aspects of epithelial barrier function, including regulation of epithelial cell growth and permeability, production of mucus and antimicrobial proteins (AMPs), and complement production.
- Formulation:
- Recombinant Human IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala34-Ile179) of human IL-22 (Accession #NP_065386.1) fused with and a 6xH
- Immunogen:
- Ala34-Ile179
- Molecular Weight:
- 17-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01616


