Recombinant Human IL-22 Protein
Product Sizes
10 ug
£145.00
RP01616-10UG
20 ug
£193.00
RP01616-20UG
50 ug
£288.00
RP01616-50UG
100 ug
£431.00
RP01616-100UG
About this Product
- SKU:
- RP01616
- Additional Names:
- Cytokine Zcyto18|IL-22|IL-D110|IL-TIF|Interleukin-22|TIFa|TIFIL-23|ZCYTO18,IL22
- Extra Details:
- Recombinant Human IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala34-Ile179) of human IL-22 (Accession #NP_065386.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala34-Ile179
- Molecular Weight:
- 17.59 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01616
