Recombinant Mouse CXCL1/GRO-alpha Protein

Product Sizes

10 ug

£145.00

RP01615-10UG

20 ug

£193.00

RP01615-20UG

50 ug

£288.00

RP01615-50UG

100 ug

£431.00

RP01615-100UG

500 ug

£1240.00

RP01615-500UG

1000 ug

£1954.00

RP01615-1000UG

About this Product

SKU:: RP01615
Additional Names:: FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1,CXCL1
Extra Details:: This antimicrobial protein belongs a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
Formulation:: Recombinant Mouse CXCL1/GRO-alpha Protein is produced by Pichia expression system. The target protein is expressed with sequence (Arg20-Lys96) of mouse CXCL1/GRO-alpha (Accession #NP_032202.1) fused w
Immunogen:: Arg20-Lys96
Molecular Weight:: 10-15 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket