Recombinant Human CCL1/I-309 Protein
Product Sizes
10 ug
£133.00
RP01613-10UG
20 ug
£181.00
RP01613-20UG
50 ug
£240.00
RP01613-50UG
About this Product
- SKU:
- RP01613
- Additional Names:
- CCL1,I-309,P500,SCYA1,SISe,TCA3
- Extra Details:
- Recombinant Human CCL1/I-309 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys24-Lys96) of human CCL1/I-309 (Accession #NP_002972.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Lys24-Lys96
- Molecular Weight:
- 8.49 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01613
