Recombinant Human CCL5/RANTES Protein
Product Sizes
10 ug
£145.00
RP01611LQ-10UG
20 ug
£193.00
RP01611LQ-20UG
50 ug
£288.00
RP01611LQ-50UG
100 ug
£431.00
RP01611LQ-100UG
About this Product
- SKU:
- RP01611LQ
- Additional Names:
- D17S136E|eoCP|RANTES|SCYA5|SIS-delta|SISd|TCP228,CCL5
- Extra Details:
- Recombinant Human CCL5/RANTES Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Ser91) of human CCL5/RANTES (Accession #NP_002976.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Supplied as a 0.22 um filtered solution in PBS, pH 7.4.
- Immunogen:
- Ser24-Ser91
- Molecular Weight:
- 8.69 kDa
- Purity:
- ≥95%
- Sequence:
- SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01611LQ




