Recombinant Monkeypox virus D6L Protein
Product Sizes
10 ug
£127.00
RP01606-10UG
20 ug
£175.00
RP01606-20UG
50 ug
£240.00
RP01606-50UG
100 ug
£336.00
RP01606-100UG
About this Product
- SKU:
- RP01606
- Additional Names:
- COP-009|D6L|IL-18 binding protein
- Extra Details:
- Recombinant Monkeypox virus D6L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val21-Lys126) of monkeypox virus D6L (Accession #Q5QC89) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val21-Lys126
- Molecular Weight:
- 12.85 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01606
