Recombinant Human CXCL7/PPBP Protein
Product Sizes
10 ug
£145.00
RP01599-10UG
20 ug
£193.00
RP01599-20UG
50 ug
£288.00
RP01599-50UG
About this Product
- SKU:
- RP01599
- Additional Names:
- PPBP,B-TG1,Beta-TG,CTAP-III,CTAP3,CTAPIII,CXCL7,LA-PF4,LDGF,MDGF,NAP-2,PBP,SCYB7,TC1,TC2,TGB,TGB1,THBGB,THBGB1
- Extra Details:
- Recombinant Human CXCL7/PPBP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala59-Asp128) of human CXCL7/PPBP (Accession #NP_002695.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala59-Asp128
- Molecular Weight:
- 7.63 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01599
