Recombinant Mouse IL-13 Protein
Product Sizes
10 ug
£163.00
RP01596-10UG
20 ug
£223.00
RP01596-20UG
50 ug
£336.00
RP01596-50UG
100 ug
£508.00
RP01596-100UG
About this Product
- SKU:
- RP01596
- Additional Names:
- Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13,IL13,Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13,IL13
- Extra Details:
- Recombinant Mouse IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser26-Phe131) of mouse IL-13 (Accession #NP_032381.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser26-Phe131
- Molecular Weight:
- 12.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01596
