Recombinant Human CCL16/HCC-4 Protein
Product Sizes
10 ug
£145.00
RP01595-10UG
20 ug
£193.00
RP01595-20UG
About this Product
- SKU:
- RP01595
- Additional Names:
- CCL16, ILINCK, NCC4, SCYA16,C-C motif chemokine 16
- Extra Details:
- Recombinant Human CCL16/HCC-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Gln120) of Human CCL16/HCC-4 (Accession # O15467) fused with with His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Gln24-Gln120
- Molecular Weight:
- 11.20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01595
