Recombinant Monkeypox virus A30L Protein
Product Sizes
10 ug
£127.00
RP01593-10UG
20 ug
£175.00
RP01593-20UG
50 ug
£240.00
RP01593-50UG
100 ug
£336.00
RP01593-100UG
About this Product
- SKU:
- RP01593
- Additional Names:
- Envelope protein A28 homolog, Protein A30,A30L
- Extra Details:
- Recombinant Monkeypox virus A30L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Leu146) of monkeypox virus A30L (Accession #NP_536567.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln22-Leu146
- Molecular Weight:
- 14.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01593
