Recombinant Mouse MUP-1 Protein
Product Sizes
10 ug
£127.00
RP01588LQ-10UG
20 ug
£157.00
RP01588LQ-20UG
100 ug
£336.00
RP01588LQ-100UG
About this Product
- SKU:
- RP01588LQ
- Additional Names:
- Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1,MUP1,Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1,MUP1
- Extra Details:
- Recombinant Mouse MUP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Glu180) of mouse MUP-1 (Accession #NP_001186924.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Supplied as a 0.22 um filtered solution in PBS, pH 7.4.
- Immunogen:
- Glu19-Glu180
- Molecular Weight:
- 19.54 kDa
- Purity:
- ≥95%
- Sequence:
- EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01588LQ
