Recombinant Human Parathormone/PTH Protein
Product Sizes
10 ug
£133.00
RP01587-10UG
20 ug
£181.00
RP01587-20UG
50 ug
£240.00
RP01587-50UG
100 ug
£353.00
RP01587-100UG
500 ug
£1002.00
RP01587-500UG
1000 ug
£1574.00
RP01587-1000UG
About this Product
- SKU:
- RP01587
- Additional Names:
- PTH, PTH1, parathyroid hormone,PTH1
- Extra Details:
- Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration inextracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cellsin bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor asparathyroid hormone and has major effects on development. Like most other protein hormones, parathyroidhormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packagedwithin the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secretedas a linear protein of 84 amino acids.
- Formulation:
- Recombinant Human Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser32-Gln115) of human Parathormone/PTH (Accession #NP_000306.1) fus
- Immunogen:
- Ser32-Gln115
- Molecular Weight:
- Approximately 15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01587
