Recombinant Human Parathormone/PTH Protein
Product Sizes
10 ug
£133.00
RP01587-10UG
20 ug
£181.00
RP01587-20UG
50 ug
£240.00
RP01587-50UG
100 ug
£353.00
RP01587-100UG
About this Product
- SKU:
- RP01587
- Additional Names:
- PTH, PTH1, parathyroid hormone,PTH1
- Extra Details:
- Recombinant Human Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser32-Gln115) of human Parathormone/PTH (Accession #NP_000306.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser32-Gln115
- Molecular Weight:
- 9.42 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01587
