Recombinant Mouse B7-DC/PD-L2/CD273 Protein
Product Sizes
10 ug
£115.00
RP01585-10UG
20 ug
£145.00
RP01585-20UG
50 ug
£193.00
RP01585-50UG
100 ug
£276.00
RP01585-100UG
About this Product
- SKU:
- RP01585
- Additional Names:
- B7-DC,B7DC,bA574F11.2,Btdc,CD273,PD-L2,PDCD1L2,PDL2,PDCD1LG2
- Extra Details:
- Recombinant Mouse B7-DC/PD-L2/CD273 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Arg219) of mouse B7-DC/PD-L2/CD273 (Accession #NP_067371.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu20-Arg219
- Molecular Weight:
- 48.5 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01585
