Recombinant Rat Sclerostin/SOST Protein
Product Sizes
10 ug
£145.00
RP01583-10UG
20 ug
£193.00
RP01583-20UG
50 ug
£288.00
RP01583-50UG
100 ug
£431.00
RP01583-100UG
500 ug
£1240.00
RP01583-500UG
1000 ug
£1954.00
RP01583-1000UG
About this Product
- SKU:
- RP01583
- Additional Names:
- sclerostin,SOST,VBCH,SOST
- Extra Details:
- Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.
- Formulation:
- Recombinant Rat Sclerostin/SOST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Tyr213) of rat Sclerostin/SOST (Accession #NP_085073.1) fuse
- Immunogen:
- Phe29-Tyr213
- Molecular Weight:
- 35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01583
