Recombinant Mouse Parathormone/PTH Protein
Product Sizes
10 ug
£133.00
RP01578-10UG
20 ug
£181.00
RP01578-20UG
50 ug
£240.00
RP01578-50UG
100 ug
£353.00
RP01578-100UG
About this Product
- SKU:
- RP01578
- Additional Names:
- Parathyroid Hormone, PTH, Parathormone, Parathyrin,PTH
- Extra Details:
- Recombinant Mouse Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys26-Gln115) of mouse Parathormone/PTH (Accession #NM_020623.2) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Lys26-Gln115
- Molecular Weight:
- 10.19 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KPVRKRAVSEIQLMHNLGKHLASMERMQWLRRKLQDMHNFVSLGVQMAARDGSHQKPTKKEENVLVDGNPKSLGEGDKADVDVLVKSKSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01578
