Recombinant Mouse BY55/CD160 Protein
Product Sizes
10 ug
£133.00
RP01573-10UG
20 ug
£181.00
RP01573-20UG
50 ug
£240.00
RP01573-50UG
100 ug
£353.00
RP01573-100UG
500 ug
£1002.00
RP01573-500UG
1000 ug
£1574.00
RP01573-1000UG
About this Product
- SKU:
- RP01573
- Additional Names:
- CD160 Antigen, Natural Killer Cell Receptor BY55, CD160, BY55,CD160
- Extra Details:
- CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in thespleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cellsand CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for bothclassical and non-classical MHC class I molecules.
- Formulation:
- Recombinant Mouse BY55/CD160 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly28-Ser160) of mouse BY55/CD160 (Accession #NP_061237.3) fused with
- Immunogen:
- Gly28-Ser160
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01573
