Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein
Product Sizes
10 ug
£127.00
RP01570-10UG
20 ug
£157.00
RP01570-20UG
50 ug
£223.00
RP01570-50UG
100 ug
£336.00
RP01570-100UG
About this Product
- SKU:
- RP01570
- Additional Names:
- 17-1A, 323/A3, ACSTD1,CD326,EGP-2, EGP314, EGP40, EpCAM, MOC31, TACST-1, TACSTD1,TROP1,EpCAM
- Extra Details:
- Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Thr266) of mouse Ep-CAM/TROP-1/CD326 (Accession #NP_032558.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln24-Thr266
- Molecular Weight:
- 28.50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01570




