Recombinant Rat B7-H1/PD-L1/CD274 Protein
Product Sizes
10 ug
£133.00
RP01568-10UG
20 ug
£181.00
RP01568-20UG
50 ug
£240.00
RP01568-50UG
100 ug
£353.00
RP01568-100UG
About this Product
- SKU:
- RP01568
- Additional Names:
- Pdcd1lg1, RGD1566211,CD274
- Extra Details:
- Recombinant Rat B7-H1/PD-L1/CD274 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Thr238) of rat B7-H1/PD-L1/CD274 (Accession #NP_001178883.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala18-Thr238
- Molecular Weight:
- 25.90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01568
