Recombinant Human S100-A4 Protein
Product Sizes
10 ug
£127.00
RP01564-10UG
20 ug
£175.00
RP01564-20UG
50 ug
£240.00
RP01564-50UG
100 ug
£336.00
RP01564-100UG
About this Product
- SKU:
- RP01564
- Additional Names:
- 18A2,42A,CAPL,FSP1,MTS1,P9KA,PEL98,S100A4, 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98, protein S100-A4
- Extra Details:
- Recombinant Human S100-A4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Lys101) of human S100-A4 (Accession #NP_002952.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala2-Lys101
- Molecular Weight:
- 11.60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01564
