Recombinant Human S100-A4 Protein
Product Sizes
10 ug
£127.00
RP01564-10UG
20 ug
£175.00
RP01564-20UG
50 ug
£240.00
RP01564-50UG
100 ug
£336.00
RP01564-100UG
500 ug
£1002.00
RP01564-500UG
1000 ug
£1574.00
RP01564-1000UG
About this Product
- SKU:
- RP01564
- Additional Names:
- 18A2,42A,CAPL,FSP1,MTS1,P9KA,PEL98,S100A4, 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98, protein S100-A4
- Extra Details:
- S100A4 belongs to the family of small calcium-binding S100 proteins containing two EF-hand calcium-binding motifs. In humans at least 20 S100 family members that are distributed tissue specifically have been identified, and are involved in a number of cellular processes as transducers of calcium signal. S100A4 is a symmetric homodimer, and undergoes a relatively large conformational change upon the typical EF-hand binding calcium, which is necessary for S100A4 to interact with its protein targets and generate biological effects. It can bind the already known targets p53, F-actin, liprin B Beta, myosin heavy chain II, and prevent their phosphorylation and multimerization. It has been demonstrated that S100A4 is directly involved in tumor metastasis including cell motility, invasion, apoptosis, angiogenesis and differentiation, and appears to be a metastasis factor and a molecular marker for clinical prognosis. Multiple alternatively spliced variants encoding the same protein have been identified.
- Formulation:
- Recombinant Human S100-A4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Lys101) of human S100-A4 (Accession #NP_002952.1) fused with no addition
- Immunogen:
- Ala2-Lys101
- Molecular Weight:
- 11-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01564
