Recombinant Mouse Sonic hedgehog protein N-product/SHH Protein
Product Sizes
10 ug
£145.00
RP01561-10UG
20 ug
£193.00
RP01561-20UG
50 ug
£288.00
RP01561-50UG
100 ug
£431.00
RP01561-100UG
500 ug
£1240.00
RP01561-500UG
1000 ug
£1954.00
RP01561-1000UG
About this Product
- SKU:
- RP01561
- Additional Names:
- 9530036O11Rik, Dsh, Hhg1, Hx, Hxl3, M100081,SHH
- Extra Details:
- This protein is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.
- Formulation:
- Recombinant Mouse Sonic hedgehog protein N-product/SHH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gly198) of mouse Sonic hedgehog prote
- Immunogen:
- Ala24-Gly198
- Molecular Weight:
- 24 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01561
