Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein
Product Sizes
10 ug
£127.00
RP01560-10UG
20 ug
£175.00
RP01560-20UG
50 ug
£240.00
RP01560-50UG
100 ug
£336.00
RP01560-100UG
About this Product
- SKU:
- RP01560
- Additional Names:
- 4-1BB ,CD137 ,CDw137 ,ILA,TNFRSF9,4-1BB ,CD137 ,CDw137 ,ILA,TNFRSF9
- Extra Details:
- Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val24-Leu211) of mouse TNFRSF9/4-1BB/CD137 (Accession #NP_001070976.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val24-Leu211
- Molecular Weight:
- 46.03 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01560




