Recombinant Mouse TREM2 Protein
Product Sizes
10 ug
£133.00
RP01558-10UG
20 ug
£181.00
RP01558-20UG
50 ug
£240.00
RP01558-50UG
100 ug
£353.00
RP01558-100UG
About this Product
- SKU:
- RP01558
- Additional Names:
- TREM-2,Trem2a,Trem2b,Trem2c,TREM2
- Extra Details:
- Recombinant Mouse TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Ser171) of mouse TREM-2 (Accession #NP_112544.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu19-Ser171
- Molecular Weight:
- 17.65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01558








