Recombinant Mouse PVR/CD155 Protein
Product Sizes
10 ug
£133.00
RP01557-10UG
20 ug
£181.00
RP01557-20UG
50 ug
£240.00
RP01557-50UG
100 ug
£353.00
RP01557-100UG
500 ug
£1002.00
RP01557-500UG
1000 ug
£1574.00
RP01557-1000UG
About this Product
- SKU:
- RP01557
- Additional Names:
- CD155,HVED,Necl-5,NECL5,PVS,TAGE4,PVR,CD155,HVED,Necl-5,NECL5,PVS,TAGE4,PVR
- Extra Details:
- The recombinant human PVR consists of 323 amino acids with a molecular weight of 35.1 kDa.CD155 is also known as PVR (poliovirus receptor) and Necl-5 (nectin-like molecule-5) It is a type I transmembrane single-span glycoprotein belonging to the nectins and nectin-like (Necl) subfamily. CD155/PVR was originally isolated based on its ability to mediate polio virus attachment to host cells. CD155 may assist in an efficient humoral immune response generated within the intestinal immune system.Commonly known as Poliovirus Receptor (PVR) due to its involvement in the cellular poliovirus infection in primates. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhension, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity.
- Formulation:
- Recombinant Mouse PVR/CD155 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp29-Leu348) of mouse PVR/CD155 (Accession #NP_081790.1) fused with a
- Immunogen:
- Asp29-Leu348
- Molecular Weight:
- 80-100 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01557


