Recombinant Mouse CD83 Protein
Product Sizes
10 ug
£127.00
RP01555-10UG
20 ug
£175.00
RP01555-20UG
50 ug
£240.00
RP01555-50UG
100 ug
£336.00
RP01555-100UG
About this Product
- SKU:
- RP01555
- Additional Names:
- BL11,HB15,CD83
- Extra Details:
- Recombinant Mouse CD83 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met22-Ala134) of mouse CD83 (Accession #NP_033986.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20 mM tris,200 mM Nacl,pH 8.0
- Immunogen:
- Met22-Ala134
- Molecular Weight:
- 13.21 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01555
