Recombinant Mouse Fc-epsilon RI-alpha/FCER1A Protein
Product Sizes
10 ug
£145.00
RP01553-10UG
20 ug
£193.00
RP01553-20UG
50 ug
£288.00
RP01553-50UG
About this Product
- SKU:
- RP01553
- Additional Names:
- FCE1A,FcERI,FCER1A
- Extra Details:
- Recombinant Mouse Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gln204) of mouse Fc-epsilon RI-alpha/FCER1A (Accession #NP_034314.2) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala24-Gln204
- Molecular Weight:
- 46.98 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01553
