Recombinant Mouse Fc-epsilon RI-alpha/FCER1A Protein
Product Sizes
10 ug
£145.00
RP01553-10UG
20 ug
£193.00
RP01553-20UG
50 ug
£288.00
RP01553-50UG
500 ug
£1240.00
RP01553-500UG
1000 ug
£1954.00
RP01553-1000UG
About this Product
- SKU:
- RP01553
- Additional Names:
- FCE1A,FcERI,FCER1A
- Extra Details:
- FCER1A is the alpha subunit of the immunoglobulin epsilon receptor (IgE receptor). IgE receptor is a high affinity IgE receptor which plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. IgE receptor is comprised of an alpha subunit(FcERI), a beta subunit, and two gamma subunits. FcERI is glycosylated and contains 2 Ig-like (immunoglobulin-like) domains.
- Formulation:
- Recombinant Mouse Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gln204) of mouse Fc-epsilon RI-alpha/FCER1A (Ac
- Immunogen:
- Ala24-Gln204
- Molecular Weight:
- 65-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01553
