Recombinant Monkeypox virus A29 Protein
Product Sizes
20 ug
£175.00
RP01543-20UG
50 ug
£240.00
RP01543-50UG
100 ug
£336.00
RP01543-100UG
About this Product
- SKU:
- RP01543
- Additional Names:
- A29L,A29,A29L,A29L,A29,A29L
- Extra Details:
- Recombinant Monkeypox virus A29 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu110) of A29 (Accession #URK20577.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Glu110
- Molecular Weight:
- 13.40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01543
