Recombinant Human PSA/KLK3 Protein
Product Sizes
10 ug
£163.00
RP01540-10UG
20 ug
£223.00
RP01540-20UG
50 ug
£336.00
RP01540-50UG
100 ug
£508.00
RP01540-100UG
500 ug
£1478.00
RP01540-500UG
1000 ug
£2335.00
RP01540-1000UG
About this Product
- SKU:
- RP01540
- Additional Names:
- APS, KLK2A1, PSA, hK3,KLK3, APS, prostate-specific antigen,KLK2A1,PSA,hK3
- Extra Details:
- KLK3 (Kallikrein Related Peptidase 3) is a Protein Coding gene. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease that is synthesized in the epithelial cells of the prostate gland and is present in seminal plasma. KLK3, also known as Prostate Specific Antigen (PSA), kallikrein-related peptidase 3, Gamma-seminoprotein, is a secreted protein of the glandular kallikrein subfamily of serine proteases. KLK3 contains one peptidase S1 domain. KLK3 is a glycoprotein produced almost exclusively by the prostate gland. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
- Formulation:
- Recombinant Human PSA/KLK3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Pro261) of human PSA/KLK3 (Accession #NP_001639.1) fused with a 6
- Immunogen:
- Ala18-Pro261
- Molecular Weight:
- 30-32 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01540
