Recombinant Human TNFSF18/GITR Ligand Protein
Product Sizes
10 ug
£133.00
RP01535-10UG
20 ug
£181.00
RP01535-20UG
50 ug
£240.00
RP01535-50UG
100 ug
£353.00
RP01535-100UG
500 ug
£1002.00
RP01535-500UG
1000 ug
£1574.00
RP01535-1000UG
About this Product
- SKU:
- RP01535
- Additional Names:
- TNFSF18,AITRL,GITRL,TL6,TNLG2A,hGITRL
- Extra Details:
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
- Formulation:
- Recombinant Human TNFSF18/GITR Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln50-Ser177) of human GITR Ligand/TNFSF18 (Accession #NP_00
- Immunogen:
- Gln50-Ser177
- Molecular Weight:
- 45-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01535
