Recombinant Mouse IL-18BP Protein
Product Sizes
10 ug
£127.00
RP01531-10UG
20 ug
£157.00
RP01531-20UG
50 ug
£223.00
RP01531-50UG
About this Product
- SKU:
- RP01531
- Additional Names:
- MC54L,Igifbp,IL-18BP,IL18BP
- Extra Details:
- Recombinant Mouse IL-18BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr29-Ala193) of mouse IL-18BP (Accession #NP_034661.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Thr29-Ala193
- Molecular Weight:
- 18.81 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01531
