Recombinant Mouse IL-18BP Protein
Product Sizes
10 ug
£127.00
RP01531-10UG
20 ug
£157.00
RP01531-20UG
50 ug
£223.00
RP01531-50UG
500 ug
£937.00
RP01531-500UG
1000 ug
£1478.00
RP01531-1000UG
About this Product
- SKU:
- RP01531
- Additional Names:
- MC54L,Igifbp,IL-18BP,IL18BP
- Extra Details:
- Interleukin-18-binding protein (IL-18BP) is a constitutively expressed and secreted protein. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18) and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to induce the expression of this receptor in NK and T cells. This gene along with four other members of the interleukin 1 receptor family, including IL1R2, IL1R1, ILRL2 (IL-1Rrp2), and IL1RL1 (T1/ST2), form a gene cluster on chromosome 2q. The adjacently located family members IL18 Receptor 1 (IL18R1) and IL18 receptor accessory protein (IL18RAP) may also be important in the development of asthma and atopy. IL-18 binding protein (IL-18BP) was only moderately elevated, resulting in a high level of biologically active free IL-18 in HPS. A severe IL-18/IL-18BP imbalance results in Th-1 lymphocyte and macrophage activation, which escapes control by NK-cell cytotoxicity and may allow for secondary HPS in patients with underlying diseases.
- Formulation:
- Recombinant Mouse IL-18BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr29-Ala193) of mouse IL-18BP (Accession #NP_034661.1) fused with a 6xH
- Immunogen:
- Thr29-Ala193
- Molecular Weight:
- 30-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01531
