Recombinant Human NKG2-D/KLRK1/CD314 Protein
Product Sizes
10 ug
£133.00
RP01530-10UG
20 ug
£181.00
RP01530-20UG
50 ug
£240.00
RP01530-50UG
100 ug
£353.00
RP01530-100UG
500 ug
£1002.00
RP01530-500UG
1000 ug
£1574.00
RP01530-1000UG
About this Product
- SKU:
- RP01530
- Additional Names:
- KLRK1,CD314,D12S2489E,KLR,NKG2-D,NKG2D
- Extra Details:
- KLRK1 (Killer Cell Lectin Like Receptor K1) is a Protein Coding gene. NKG2D, also known as CD314, is an immune receptor that consists of two disulfide-linked type II transmembrane proteins with short intracellular proteins incapable to transduce signals. To transduce signals, NKG2D needs adaptor proteins and it uses two adaptor proteins, DAP10 and DAP12. These two adaptor proteins associate as homodimers to NKG2D- therefore the entire receptor complex appears as a hexamer. NKG2D can send co-stimulatory signals to activate CD8 T cells. NKG2D also plays an important role in viral control. Cellular stress can induce ligands for NKG2D which results in the cell susceptible to NK cell-mediated lysis.
- Formulation:
- Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile73-Val216) of human NKG2-D/KLRK1/CD314 (Accession #NP_0313
- Immunogen:
- Ile73-Val216
- Molecular Weight:
- 50-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALY ASSFKGYIENCSTPNTYICMQRTV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01530
