Recombinant Mouse NKp46/NCR1/CD335 Protein
Product Sizes
10 ug
£133.00
RP01525-10UG
20 ug
£181.00
RP01525-20UG
50 ug
£240.00
RP01525-50UG
100 ug
£353.00
RP01525-100UG
500 ug
£1002.00
RP01525-500UG
1000 ug
£1574.00
RP01525-1000UG
About this Product
- SKU:
- RP01525
- Additional Names:
- Ly94,NKp46,Ncr1
- Extra Details:
- NCR1, also known as NK-p46 and CD335, is a natural cytotoxicity receptor(NCR). NCRs are type I transmembrane proteins with 1-2 extracellular immunoglobulin domains, a transmembrane domain containing a positively charged amino acid residue, and a short cytoplasmic tail. All are expressed almost exclusively by NK cells and play a major role in triggering NK-mediated killing of most tumor cell lines. NKp46 has two extracellular Ig-like domains followed by a ~40 residue stalk region, a type I transmembrane domain, and a short cytoplasmic tail. NKp46 has been implicated in NK cell-mediated lysis of several autologous tumor cells, pathogen-infected cell lines, and mononuclear phagocytes infected with an intracellular bacterium.
- Formulation:
- Recombinant Mouse NKp46/NCR1/CD335 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln17-Asn255) of mouse NCR1/CD335 (Accession #NP_034876.2) fuse
- Immunogen:
- Gln17-Asn255
- Molecular Weight:
- 70-80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01525
