Recombinant Mouse Ephrin-A2/EFNA2 Protein
Product Sizes
10 ug
£127.00
RP01515-10UG
20 ug
£175.00
RP01515-20UG
50 ug
£240.00
RP01515-50UG
100 ug
£336.00
RP01515-100UG
500 ug
£1002.00
RP01515-500UG
1000 ug
£1574.00
RP01515-1000UG
About this Product
- SKU:
- RP01515
- Additional Names:
- Elf1,Epl6,CEK7L,Eplg6,Lerk6,EFNA2
- Extra Details:
- Ephrin-A2 also known as EFNA2 or EPH-related receptor tyrosine kinase ligand 6, is a member of the ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Ephrin-A2 and their Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A2 regulates the position-specific affinity of limb mesenchyme and is involved in cartilage pattern formation in the limb.
- Formulation:
- Recombinant Mouse Ephrin-A2/EFNA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg21-Asn184) of mouse Ephrin-A2 (Accession #NP_031935.3) fused
- Immunogen:
- Arg21-Asn184
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01515


