Recombinant Mouse Ephrin-A2/EFNA2 Protein
Product Sizes
10 ug
£127.00
RP01515-10UG
20 ug
£175.00
RP01515-20UG
50 ug
£240.00
RP01515-50UG
100 ug
£336.00
RP01515-100UG
About this Product
- SKU:
- RP01515
- Additional Names:
- Elf1,Epl6,CEK7L,Eplg6,Lerk6,EFNA2
- Extra Details:
- Recombinant Mouse Ephrin-A2/EFNA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg21-Asn184) of mouse Ephrin-A2 (Accession #NP_031935.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg21-Asn184
- Molecular Weight:
- 19.71 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01515
