Recombinant Mouse CD69 Protein
Product Sizes
10 ug
£145.00
RP01508-10UG
20 ug
£193.00
RP01508-20UG
50 ug
£288.00
RP01508-50UG
100 ug
£431.00
RP01508-100UG
500 ug
£1240.00
RP01508-500UG
1000 ug
£1954.00
RP01508-1000UG
About this Product
- SKU:
- RP01508
- Additional Names:
- AIM Protein,Human,BL-AC/P26 Protein,Human,CLEC2C Protein,Human,EA1 Protein,Human,GP32/28 Protein,Human,MLR-3 Protein,Human,CD69
- Extra Details:
- Early activation antigen CD69, also known as activation inducer molecule (AIM), is a single-pass type II membrane protein. Recently, cDNA clones encoding human and mouse CD69 were isolated and showed CD69 to be a member of the C-type lectin superfamily. It is one of the earliest cell surface antigens expressed by T cells following activation. Once expressed, CD69 acts as a costimulatory molecule for T cell activation and proliferation. In addition to mature T cells, CD69 is inducibly expressed by immature thymocytes, B cells, natural killer (NK) cells, monocytes, neutrophils and eosinophils, and is constitutively expressed by mature thymocytes and platelets. CD69 is involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. The structure, chromosomal localization, expression and function of CD69 suggest that it is likely a pleiotropic immune regulator , potentially important in the activation and differentiation of a wide variety of hematopoietic cells. This membrane molecule transiently expresses on activated lymphocytes, and its selective expression in inflammatory infiltrates suggests that it plays a role in the pathogenesis of inflammatory diseases. CD69 plays a crucial role in the pathogenesis of allergen-induced eosinophilic airway inflammation and hyperresponsiveness and that CD69 could be a possible therapeutic target for asthmatic patients.
- Formulation:
- Recombinant Mouse CD69 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn62-Arg199) of mouse CD69 (Accession #NP_001028294.1) fused with a 6xHis
- Immunogen:
- Asn62-Arg199
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01508
