Recombinant Human GOLPH2/GOLM1 Protein
Product Sizes
10 ug
£133.00
RP01505-10UG
20 ug
£181.00
RP01505-20UG
50 ug
£240.00
RP01505-50UG
100 ug
£353.00
RP01505-100UG
About this Product
- SKU:
- RP01505
- Additional Names:
- C9orf155, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3,GOLM1,GOLPH2,GP73,HEL46,PSEC0257,bA379P1.3
- Extra Details:
- Recombinant Human GOLPH2/GOLM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser36-Leu401) of human GOLPH2/GOLM1 (Accession #NP_057632.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser36-Leu401
- Molecular Weight:
- 42.42 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01505
