Recombinant Human Apolipoprotein H/ApoH Protein
Product Sizes
10 ug
£127.00
RP01498-10UG
20 ug
£175.00
RP01498-20UG
50 ug
£240.00
RP01498-50UG
100 ug
£336.00
RP01498-100UG
500 ug
£1002.00
RP01498-500UG
1000 ug
£1574.00
RP01498-1000UG
About this Product
- SKU:
- RP01498
- Additional Names:
- APOH,B2G1,B2GP1,BG
- Extra Details:
- Apolipoprotein H (APOH), also known as Beta-2-glycoprotein 1, Activated protein C-binding protein, B2GPI, and B2G1, is a glycoprotein synthesized by liver cells and it is present in the blood associated with plasma lipoproteins. It is an essential cofactor for the binding of certain antiphospholipid antibodies (APA) to anionic phospholipid. APOH binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. APOH may prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells. APOH appears to completely inhibit serotonin release by the platelets and prevents subsequent waves of the ADP-induced aggregation. The activity of APOH appears to involve the binding of agglutenating, negatively charged compounds, and inhibits agglutenation by the contact activation of the intrinsic blood coagulation pathway.
- Formulation:
- Recombinant Human Apolipoprotein H/ApoH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly20-Cys345) of human APOH (Accession #NP_000033.2) fused
- Immunogen:
- Gly20-Cys345
- Molecular Weight:
- 30-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01498
