Recombinant Human DC-SIGN/CD209 Protein
Product Sizes
10 ug
£145.00
RP01489-10UG
20 ug
£193.00
RP01489-20UG
50 ug
£288.00
RP01489-50UG
100 ug
£431.00
RP01489-100UG
500 ug
£1240.00
RP01489-500UG
1000 ug
£1954.00
RP01489-1000UG
About this Product
- SKU:
- RP01489
- Additional Names:
- CD209,CDSIGN,CLEC4L,DC-SIGN,DC-SIGN1, CLEC4L, DC-SIGN, DC-SIGN1
- Extra Details:
- Dendritic cell (DC)-specific intercellular adhesion molecule 3 (ICAM-3) grabbing nonintegrin (DC-SIGN), also known as CD209, is a type II transmembrane protein on DCs with a C-type lectin extracellular domain, is capable of binding ICAM-3 on resting T cells in the secondary lymphoid organs, providing the initial contact between these cells during the establishment of cell-mediated immunity. It is not only a pattern recognition receptor but implicated in immunoregulation of DCs. It has an important role in mediating DC adhesion, migration, inflammation, activating primary T cell, triggering immune response and participating in immune escape of pathogens and tumors. DC-SIGN also mediates the capture and internalization of viral, bacterial, and fungal pathogens by dendritic cells, such as HIV-1, Ebola virus, cytomegalovirus, Dengue virus, and hepatitis C virus. DC-SIGN is unique in that it regulates adhesion processes, such as DC trafficking and T-cell synapse formation, as well as antigen capture. Moreover, even though several C-type lectins have been shown to bind HIV-1, DC-SIGN does not only capture HIV-1 but also protects it in early endosomes allowing HIV-1 transport by DC to lymphoid tissues, where it enhances trans infection of T cells.
- Formulation:
- Recombinant Human DC-SIGN/CD209 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln59-Ala404) of human CD209/DC-SIGN (Accession #NP_066978.1) fuse
- Immunogen:
- Gln59-Ala404
- Molecular Weight:
- 40-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01489
