Recombinant Mouse SPINK4 Protein
Product Sizes
10 ug
£145.00
RP01487-10UG
20 ug
£193.00
RP01487-20UG
About this Product
- SKU:
- RP01487
- Additional Names:
- SPINK4,MPGC60,SPINK4
- Extra Details:
- Recombinant Mouse SPINK4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly27-Cys86) of mouse SPINK4/MPGC60 (Accession #NP_035593.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly27-Cys86
- Molecular Weight:
- 7.64 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01487




