Recombinant Mouse IL-2RA/CD25 Protein
Product Sizes
10 ug
£133.00
RP01481-10UG
About this Product
- SKU:
- RP01481
- Additional Names:
- CD25, Il2r, Ly-43, p55, CD25, IL2R, IMD41, TCGFR, IDDM10
- Extra Details:
- Recombinant Mouse IL-2RA/CD25 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu22-Lys236) of mouse CD25/IL-2Ralpha (Accession #NP_032393.3) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu22-Lys236
- Molecular Weight:
- 50.63 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01481
